PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G166000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 326aa    MW: 33508.1 Da    PI: 7.9444
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G166000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.62.8e-1540100257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  Brast02G166000.1.p  40 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 100
                         89*****************99*************************************997 PP

2Wus_type_Homeobox106.81.3e-3439102265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
  Brast02G166000.1.p  39 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 102
                         589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2436101IPR001356Homeobox domain
SuperFamilySSF466896.42E-1438108IPR009057Homeodomain-like
SMARTSM003891.2E-638105IPR001356Homeobox domain
PfamPF000465.3E-1340100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-840107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEGSSKSPDG GQSSGGSPEE RGRSGGGGGG GRGAGDQPVR SRWTPKPEQI LILESIFNSG  60
MVNPPKDETV RIRKLLERFG AVGDANVFYW FQNRRSRSRR RQRQMQAAAA AAAANNNNNT  120
SSPAAASGAS IGGQLPSTMA IVGGSACCQY EQQQASSSSS SGSTAGGSSS LGLFAAHGAA  180
GASSGVGYQL LQQQQCGASL SALANSGLMA GDVGDSDDLF AISRQMGFVD HSAVGSSSSA  240
APTSAVQQQQ QQYYSSCQLP TATITVFING VPMEVPRGPI DLRAMFGQDV VLVHSSGALL  300
PVNDYGILIQ SLQMGESYFL VARQT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370701e-110AC137070.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0035J18, from chromsome 3, complete sequence.
GenBankAK1110001e-110AK111000.1 Oryza sativa Japonica Group cDNA clone:002-174-E11, full insert sequence.
GenBankAP0149591e-110AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-110CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558004.11e-130PREDICTED: WUSCHEL-related homeobox 6-like
SwissprotA2XG773e-95WOX6_ORYSI; WUSCHEL-related homeobox 6
TrEMBLA0A0Q3KBW01e-130A0A0Q3KBW0_BRADI; Uncharacterized protein
STRINGMLOC_65745.21e-103(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.22e-31WUSCHEL related homeobox 12